Protein Info for EX28DRAFT_3858 in Enterobacter asburiae PDN3

Annotation: serine O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF06426: SATase_N" amino acids 9 to 113 (105 residues), 136.7 bits, see alignment E=3.6e-44 TIGR01172: serine O-acetyltransferase" amino acids 82 to 242 (161 residues), 250.8 bits, see alignment E=3.1e-79 PF00132: Hexapep" amino acids 193 to 226 (34 residues), 38 bits, see alignment 8.8e-14

Best Hits

Swiss-Prot: 98% identical to CYSE_SALTY: Serine acetyltransferase (cysE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 96% identity to ecv:APECO1_2848)

MetaCyc: 96% identical to serine acetyltransferase (Escherichia coli K-12 substr. MG1655)
Serine O-acetyltransferase. [EC: 2.3.1.30]

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.30

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>EX28DRAFT_3858 serine O-acetyltransferase (Enterobacter asburiae PDN3)
MPCEELDIVWNNIKAEARALADCEPMLASFYHATLLKHENLGSALSYMLANKLASSIMPA
IAIREVVEEAYAADPEMIASAACDIQAVRTRDPAVDKYSTPLLYLKGFHALQAYRIGHWL
WNEGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHATGIVVGETAVIEDDVSILQSV
TLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVP
ARIVGKPDSDKPSMDMDQHFNGIHHTFEYGDGI