Protein Info for EX28DRAFT_3855 in Enterobacter asburiae PDN3

Annotation: L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 332 to 350 (19 residues), see Phobius details PF01070: FMN_dh" amino acids 13 to 375 (363 residues), 421.8 bits, see alignment E=2.2e-130

Best Hits

Swiss-Prot: 96% identical to LLDD_ENT38: L-lactate dehydrogenase (lldD) from Enterobacter sp. (strain 638)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 98% identity to enc:ECL_00160)

MetaCyc: 94% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>EX28DRAFT_3855 L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases (Enterobacter asburiae PDN3)
MIISAASDYRAAAQRILPPFLFHYIDGGAYAEYTLRRNAEDLSEVALRQRVLKNMSDLSL
ETKLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTI
KRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAALR
RYWQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWI
REFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGD
IAILADSGIRNGLDVVRMIALGADSVLLGRAYLYALATAGQAGVANLLNLIEKEMKVAMT
LTGARTISEISKDSLVQELSKLPAALAPLAQGNAA