Protein Info for EX28DRAFT_3854 in Enterobacter asburiae PDN3

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00392: GntR" amino acids 8 to 71 (64 residues), 77.7 bits, see alignment E=4.4e-26 PF07729: FCD" amino acids 100 to 222 (123 residues), 89.5 bits, see alignment E=2.4e-29

Best Hits

Swiss-Prot: 83% identical to LLDR_SHIFL: Putative L-lactate dehydrogenase operon regulatory protein (lldR) from Shigella flexneri

KEGG orthology group: K14348, GntR family transcriptional regulator, L-lactate dehydrogenase operon regulator (inferred from 98% identity to enc:ECL_00161)

Predicted SEED Role

"Lactate-responsive regulator LldR in Enterobacteria, GntR family" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>EX28DRAFT_3854 Transcriptional regulators (Enterobacter asburiae PDN3)
MIVMPRRLSDEIASRVRALIEEQQLEAGMKLPAERQLATQLGVSRNSLREALARLVSEGV
LVSRRGGGTFVRWQHDDWSEQNIVQPLKTLMENDPDYSFDILEARHAIETSTAWHAAMRA
TDADKEKLIACFEATQSSDPDIASQADVRFHLAIAEASHNVVLLQTMRGFFDLLQSSVKQ
SRQRMYLVPPVFAQLTEQHEAVLNAILAGDAEAARKAMMAHLGFVHTTIKRFDEDQARQA
RITRLPGDSDISRENKA