Protein Info for EX28DRAFT_3838 in Enterobacter asburiae PDN3

Annotation: Fe-S-cluster-containing hydrogenase components 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF12837: Fer4_6" amino acids 4 to 24 (21 residues), 24.5 bits, see alignment (E = 7.7e-09) amino acids 79 to 98 (20 residues), 26.6 bits, see alignment (E = 1.7e-09) PF12800: Fer4_4" amino acids 10 to 24 (15 residues), 15.9 bits, see alignment (E = 5.5e-06) amino acids 82 to 97 (16 residues), 20.8 bits, see alignment (E = 1.5e-07) PF13247: Fer4_11" amino acids 51 to 135 (85 residues), 42.6 bits, see alignment E=2.3e-14 PF12797: Fer4_2" amino acids 77 to 96 (20 residues), 26.4 bits, see alignment (E = 1.8e-09) PF13237: Fer4_10" amino acids 78 to 130 (53 residues), 28.4 bits, see alignment E=5.4e-10 PF00037: Fer4" amino acids 80 to 99 (20 residues), 29 bits, see alignment (E = 2.6e-10)

Best Hits

Swiss-Prot: 66% identical to YSAA_ECOLI: Putative electron transport protein YsaA (ysaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 78% identity to enc:ECL_00193)

MetaCyc: 41% identical to CooF ferredoxin-type iron-sulfur protein (Rhodospirillum rubrum)
1.2.7.4,2.3.3.M4,2.3.3.M4,2.3.3.M5 [EC: 1.2.7.4, 2.3.3.M4, 2.3.3.M5]

Predicted SEED Role

"Electron transport protein HydN"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.7.4 or 2.3.3.M4 or 2.3.3.M5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>EX28DRAFT_3838 Fe-S-cluster-containing hydrogenase components 2 (Enterobacter asburiae PDN3)
MNRFIVADAEKCIGCRTCEVACAVSHQDAVSAHAFSPRLRVVKGDDYTTAVGCHQCEDAP
CANVCPTHAISRTAGAWLVEQTRCIGCKSCMVACPFGAMQVRLEGNKPQALKCDLCLHRE
GGPACVEACPTCALRCVEPARLRAERLHNLA