Protein Info for EX28DRAFT_3816 in Enterobacter asburiae PDN3

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 257 (240 residues), 150.2 bits, see alignment E=7.4e-48 amino acids 267 to 420 (154 residues), 57.9 bits, see alignment E=8.5e-20 PF00083: Sugar_tr" amino acids 48 to 411 (364 residues), 39.1 bits, see alignment E=4.6e-14

Best Hits

KEGG orthology group: None (inferred from 99% identity to enc:ECL_00215)

Predicted SEED Role

"2-ketogluconate transporter" in subsystem 2-Ketogluconate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>EX28DRAFT_3816 Sugar phosphate permease (Enterobacter asburiae PDN3)
MNSSTNAVKRWWYIMPIVFITYSLAYLDRANFSFASAAGITEDLGITKGISSLLGALFFL
GYFFFQIPGAIYAERRSVRKLIFVCLILWGACASLTGVVNNIPALAAIRFILGVVEAAVM
PAMLIYISKWFTKSERSRANTFLILGNPVTVLWMSVVSGYLIQSFGWREMFIIEGVPAVI
WAFCWWVLVKDKPAQAKWLSEDEKAALQAQLDKEQQGLKAVRNYGEAFRSRNVILLCAQY
FTWSIGVYGFVLWLPSIIRSGGENLGMVEVGWLSSVPYLAATIAMIVVSWASDKLQNRKL
FVWPLLLIAAFAFIGSWAVGANHFWASYTLLVVAGAAMYAPYGPFFAIIPEMLPRNVAGG
AMALINSMGALGSFCGSWFVGYLNGATGSPSASYIFMGVALFASVWLTLIVKPANNQQHP
VGARHA