Protein Info for EX28DRAFT_3776 in Enterobacter asburiae PDN3

Annotation: tRNA(Ile)-lysidine synthetase, N-terminal domain/tRNA(Ile)-lysidine synthetase, C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF01171: ATP_bind_3" amino acids 15 to 192 (178 residues), 197.3 bits, see alignment E=3e-62 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 16 to 197 (182 residues), 167.9 bits, see alignment E=2.4e-53 PF09179: TilS" amino acids 242 to 309 (68 residues), 74.3 bits, see alignment E=1.2e-24 PF11734: TilS_C" amino acids 357 to 426 (70 residues), 86.2 bits, see alignment E=1.1e-28 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 357 to 402 (46 residues), 60.4 bits, see alignment 8.5e-21

Best Hits

Swiss-Prot: 74% identical to TILS_ENT38: tRNA(Ile)-lysidine synthase (tilS) from Enterobacter sp. (strain 638)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 74% identity to ent:Ent638_0726)

MetaCyc: 68% identical to tRNAIle-lysidine synthetase (Escherichia coli K-12 substr. MG1655)
RXN-1961 [EC: 6.3.4.19]

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>EX28DRAFT_3776 tRNA(Ile)-lysidine synthetase, N-terminal domain/tRNA(Ile)-lysidine synthetase, C-terminal domain (Enterobacter asburiae PDN3)
MTLPAIAQAVSPYRQLLVGFSGGLDSTVLLHRLKRWRDREPDVQLRAMHIHHGLSPHAEA
WVAHCEALCAAWAIPLIVERVTLAEEGLGIEAQARKARYAAFAGALRPGEALVTAQHLDD
QCETFLLALKRGSGPAGLSAMPARSEFAGTTLLRPLLGETRASLENWAREHQLNWIEDES
NQDDGYDRNFLRLRVLPLLGERWPHFADATARSAMLCAEQESLLDELLSDELAGLISADG
ALAIAPMKAMSPVRRAALLRRWLAFHRAAMPSRTMLSRIWDEVALARDDASPCVHLNGFE
VRRYKGELWWVKSTPSLTDVVLDWLSPDAPLPLPCESGRVSLLPSGHVRLPKPGEPVTVR
FKAGGMLHIVGRNGGRKLKKIWQECNVPPWLRDTTPLLFYGETLIAAAGVFITEEGWSEE
GVRFEWQKA