Protein Info for EX28DRAFT_3762 in Enterobacter asburiae PDN3

Annotation: undecaprenyl diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 18 to 243 (226 residues), 342.6 bits, see alignment E=4.5e-107 PF01255: Prenyltransf" amino acids 23 to 243 (221 residues), 284.3 bits, see alignment E=3.2e-89

Best Hits

Swiss-Prot: 92% identical to UPPS_SALPA: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific) (uppS) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 96% identity to ent:Ent638_0712)

MetaCyc: 89% identical to ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (Escherichia coli K-12 substr. MG1655)
Di-trans,poly-cis-decaprenylcistransferase. [EC: 2.5.1.31]

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>EX28DRAFT_3762 undecaprenyl diphosphate synthase (Enterobacter asburiae PDN3)
MLSANQPISENLPAHGCRHVAIIMDGNGRWAKRQGKIRAFGHKAGAKSVRRAVSFAANNG
IDALTLYAFSSENWNRPLQEVTALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQ
ERIRKAEALTENNTGLTLNIAANYGGRWDIIQGVRHLAEQVQEGLLRPDQIDEEALSKQI
CMNEQAPVDLVIRTGGEHRISNFLIWQIAYAELYFTDVLWPDFDEQDFEGALHAFANRER
RFGGTEPGGDKA