Protein Info for EX28DRAFT_3750 in Enterobacter asburiae PDN3

Annotation: periplasmic serine protease, Do/DeqQ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 41 to 476 (436 residues), 553.5 bits, see alignment E=1.8e-170 PF00089: Trypsin" amino acids 112 to 279 (168 residues), 86.7 bits, see alignment E=5.5e-28 PF13365: Trypsin_2" amino acids 118 to 254 (137 residues), 119.7 bits, see alignment E=4.4e-38 PF00595: PDZ" amino acids 291 to 371 (81 residues), 55.2 bits, see alignment E=1.9e-18 amino acids 395 to 467 (73 residues), 50.4 bits, see alignment E=6.1e-17 PF13180: PDZ_2" amino acids 312 to 384 (73 residues), 55.8 bits, see alignment E=1.1e-18 amino acids 410 to 469 (60 residues), 37.4 bits, see alignment E=6.4e-13 PF17820: PDZ_6" amino acids 319 to 359 (41 residues), 41.6 bits, see alignment 2e-14 amino acids 416 to 468 (53 residues), 37.7 bits, see alignment 3.5e-13

Best Hits

Swiss-Prot: 92% identical to DEGP_SALTY: Periplasmic serine endoprotease DegP (degP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04771, serine protease Do [EC: 3.4.21.107] (inferred from 99% identity to enc:ECL_00965)

MetaCyc: 91% identical to periplasmic serine endoprotease DegP (Escherichia coli K-12 substr. MG1655)
Peptidase Do. [EC: 3.4.21.107]

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>EX28DRAFT_3750 periplasmic serine protease, Do/DeqQ family (Enterobacter asburiae PDN3)
MKKTTLAMSALALSLGLALSPLTATAAETASSAATAQQMPSLAPMLEKVMPSVVSINVEG
STTVNTPRMPRNFQQFFGDNSPFCQDGSPFQSSPFCQGGGAGDDSQGGGQQQKFMALGSG
VIIDAAKGYVVTNNHVVDNANSIKVQLSDGRKFDAKVVGKDPRSDIALIQIQDPKNLTAI
KIADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNS
GGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVQYGQVKRGELGILGT
ELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSLNGKPISSFAALRAEVGS
MPIGSKVTLGLLRDGKPVNVSLELQQSSQNQVDSSTIFSGIEGAEMSNKGADKGVVVNNV
KANSPAARIGLKKGDVIMGANQQPVKNIAELRKILDSKPSVLALNIQRGDTSLYLLMQ