Protein Info for EX28DRAFT_3733 in Enterobacter asburiae PDN3
Annotation: glutamyl-queuosine tRNA(Asp) synthetase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 79% identical to GLUQ_ECOL6: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 90% identity to enc:ECL_00948)MetaCyc: 79% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]
Predicted SEED Role
"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 6.1.1.-
Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (296 amino acids)
>EX28DRAFT_3733 glutamyl-queuosine tRNA(Asp) synthetase (Enterobacter asburiae PDN3) MSESHYIGRFAPSPSGELHFGSLIAALGSYLQARARLGKWLVRIEDIDPPREVPGTAETI LRQLEHYGLHWDDEVLWQSKRHEAYRERLAWLRVRGLSYNCTCTRARIQSVGGVYDGHCR TLNLPPENAAVRIKQRSPVTRFTDLLSGEIHADERLAREDFIIHRRDGLFAYNLAVVVDD RFQGVTEIVRGADLVEPTVRQISLYHQFGWTAPDYIHLPLAVNAQGFKLSKQNHAPALPD GDPRPVLIDALRFLNQNVTNEWQDLRIDELLKMAVANWTLAAVPKIQHSQMRCAEL