Protein Info for EX28DRAFT_3733 in Enterobacter asburiae PDN3

Annotation: glutamyl-queuosine tRNA(Asp) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 6 to 270 (265 residues), 365.1 bits, see alignment E=1.1e-113 PF00749: tRNA-synt_1c" amino acids 9 to 271 (263 residues), 146.9 bits, see alignment E=3.4e-47

Best Hits

Swiss-Prot: 79% identical to GLUQ_ECOL6: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 90% identity to enc:ECL_00948)

MetaCyc: 79% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>EX28DRAFT_3733 glutamyl-queuosine tRNA(Asp) synthetase (Enterobacter asburiae PDN3)
MSESHYIGRFAPSPSGELHFGSLIAALGSYLQARARLGKWLVRIEDIDPPREVPGTAETI
LRQLEHYGLHWDDEVLWQSKRHEAYRERLAWLRVRGLSYNCTCTRARIQSVGGVYDGHCR
TLNLPPENAAVRIKQRSPVTRFTDLLSGEIHADERLAREDFIIHRRDGLFAYNLAVVVDD
RFQGVTEIVRGADLVEPTVRQISLYHQFGWTAPDYIHLPLAVNAQGFKLSKQNHAPALPD
GDPRPVLIDALRFLNQNVTNEWQDLRIDELLKMAVANWTLAAVPKIQHSQMRCAEL