Protein Info for EX28DRAFT_3724 in Enterobacter asburiae PDN3

Annotation: ABC-type multidrug transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF00005: ABC_tran" amino acids 21 to 165 (145 residues), 117.3 bits, see alignment E=8.3e-38 PF13304: AAA_21" amino acids 131 to 194 (64 residues), 33.5 bits, see alignment E=4.7e-12

Best Hits

Swiss-Prot: 94% identical to YADG_ECOLI: Uncharacterized ABC transporter ATP-binding protein YadG (yadG) from Escherichia coli (strain K12)

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 97% identity to enc:ECL_00932)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>EX28DRAFT_3724 ABC-type multidrug transport system, ATPase component (Enterobacter asburiae PDN3)
MAIALELEQLKKTYPGGVQALREIDLQVEAGDFYALLGPNGAGKSTTIGIISSLVNKTSG
RVSVFGYDLQKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAGYYGVERKEALERSEKY
LKQLDLWEKRNERARMLSGGMKRRLMIARALMHEPKLLILDEPTAGVDIELRRSMWGFLK
DLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKNLLSKLKSETFILDLAAKS
ALPKLEGYNYRLVDTSTLEVEVLREQGINSVFSQLSAQGIQVLSMRNKANRLEELFVSLV
HDKQGDKA