Protein Info for EX28DRAFT_3719 in Enterobacter asburiae PDN3

Annotation: Bacterial chaperone lipoprotein (PulS_OutS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details PF09691: T2SS_PulS_OutS" amino acids 37 to 118 (82 residues), 38.3 bits, see alignment E=6.1e-14

Best Hits

Swiss-Prot: 96% identical to YACC_ECOLI: Uncharacterized protein YacC (yacC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ent:Ent638_0670)

Predicted SEED Role

"Predicted chaperone lipoprotein YacC, potentially involved in protein secretion" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>EX28DRAFT_3719 Bacterial chaperone lipoprotein (PulS_OutS) (Enterobacter asburiae PDN3)
MLTLIFREEVVEAMKTFFRTILFGSLMAMCANSYALSENEAEDMADLTAVFVFLKNDCGY
QNLPNGQIRRALVFFAQQNQWDLSNYDSFDMKALGEDSYRDLSGIGIPTAKKCKALARDS
LSLLAYVK