Protein Info for EX28DRAFT_3694 in Enterobacter asburiae PDN3

Annotation: mutator mutT protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 TIGR00586: mutator mutT protein" amino acids 1 to 126 (126 residues), 200.6 bits, see alignment E=4.1e-64 PF14815: NUDIX_4" amino acids 7 to 123 (117 residues), 76.5 bits, see alignment E=1.5e-25 PF00293: NUDIX" amino acids 7 to 123 (117 residues), 79.5 bits, see alignment E=2.4e-26

Best Hits

Swiss-Prot: 77% identical to MUTT_ECOLI: 8-oxo-dGTP diphosphatase (mutT) from Escherichia coli (strain K12)

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 92% identity to enc:ECL_00897)

MetaCyc: 77% identical to 8-oxo-dGTP diphosphatase (Escherichia coli K-12 substr. MG1655)
RXN-12816 [EC: 3.6.1.58]; 3.6.1.58 [EC: 3.6.1.58]; RXN-11396 [EC: 3.6.1.58, 3.6.1.55]; 3.6.1.55 [EC: 3.6.1.58, 3.6.1.55]

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.55 or 3.6.1.58

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>EX28DRAFT_3694 mutator mutT protein (Enterobacter asburiae PDN3)
MKILQIAVGIIRNPQNQIFITQRAADAHMANKWEFPGGKIESGETPEEALVRELQEEVGI
IPLGATLFDKLEYQFPDRHITLWFWLVENWEGEPWGKEGQPGNWVELQASDAEKFPPANE
SVILRLVAQP