Protein Info for EX28DRAFT_3692 in Enterobacter asburiae PDN3

Annotation: Secretion monitor precursor protein (SecM)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF06558: SecM" amino acids 27 to 167 (141 residues), 180.8 bits, see alignment E=7.9e-58

Best Hits

Swiss-Prot: 70% identical to SECM_CITK8: Secretion monitor (secM) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K13301, secretion monitor (inferred from 91% identity to enc:ECL_00894)

Predicted SEED Role

"Secretion monitor precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>EX28DRAFT_3692 Secretion monitor precursor protein (SecM) (Enterobacter asburiae PDN3)
MEQVSGILTRWRQFGRRYFWPHLLLGMVAASFGLPALSNSAEAATPAKTSTTKHDLNTRV
NFTNLAWLEASRRPNFSVDYWHQHAIRTVIRHLSFAMAPQAMPVAEEALPVQAQHLALLD
TLNALLTQDSQPPVMVRQTTQRALVSPASFSVSTWISQAHGIRAGPQRLS