Protein Info for EX28DRAFT_3678 in Enterobacter asburiae PDN3

Annotation: cell division protein FtsL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details PF04999: FtsL" amino acids 25 to 119 (95 residues), 128.6 bits, see alignment E=3.6e-42 TIGR02209: cell division protein FtsL" amino acids 36 to 118 (83 residues), 94.6 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 94% identical to FTSL_SALTY: Cell division protein FtsL (ftsL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03586, cell division protein FtsL (inferred from 100% identity to enc:ECL_00880)

Predicted SEED Role

"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>EX28DRAFT_3678 cell division protein FtsL (Enterobacter asburiae PDN3)
MIGRVTETLSKVKDSLGSNERHALPGVIGDDLLRFGKLPLCLFICIIVTAVTVVTTAHHT
RLLTAQREQMVLERDALDIEWRNLILEENALGDHSRVERIATEKLQLQHVDPSQENIVVQ
K