Protein Info for EX28DRAFT_3675 in Enterobacter asburiae PDN3

Annotation: transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR02417: D-fructose-responsive transcription factor" amino acids 2 to 328 (327 residues), 515 bits, see alignment E=4.3e-159 PF00356: LacI" amino acids 3 to 50 (48 residues), 64.8 bits, see alignment 9.4e-22 PF00532: Peripla_BP_1" amino acids 62 to 312 (251 residues), 50.4 bits, see alignment E=4.7e-17 PF13407: Peripla_BP_4" amino acids 64 to 284 (221 residues), 37.5 bits, see alignment E=4.1e-13 PF13377: Peripla_BP_3" amino acids 182 to 321 (140 residues), 40.3 bits, see alignment E=7e-14

Best Hits

Swiss-Prot: 98% identical to CRA_ECOLI: Catabolite repressor/activator (cra) from Escherichia coli (strain K12)

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 99% identity to enc:ECL_00876)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>EX28DRAFT_3675 transcriptional regulator, LacI family (Enterobacter asburiae PDN3)
MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNAVAAGLRAGR
TRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPDNEMRCIEHLLQRQVDA
IIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGADQDDAEMLAAELRTFPAE
TVLYLGALPELSVSFLREQGFRTAWKDDPREVHYLYANSYEREAAAQLFEKWLETHPMPQ
ALFTTSFALLQGVMDVTLRREGKLPSDLAIATFGDNELLDFLQCPVLAVAQRHRDVAERV
LEIVLASLDEPRKPKPGLTRIKRNLYHRGILSRQK