Protein Info for EX28DRAFT_3657 in Enterobacter asburiae PDN3

Annotation: Uncharacterized membrane-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details PF09335: VTT_dom" amino acids 36 to 159 (124 residues), 73.3 bits, see alignment E=1.3e-24

Best Hits

Swiss-Prot: 85% identical to YABI_ECOLI: Inner membrane protein YabI (yabI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to enc:ECL_00861)

Predicted SEED Role

"DedA family inner membrane protein YabI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>EX28DRAFT_3657 Uncharacterized membrane-associated protein (Enterobacter asburiae PDN3)
MQALLEHFITQSVMYSLIAVALVAFLESLALVGLILPGTVMMAGLGALIGSGEVNFWQAW
LAGIIGCLLGDWISFWLGWRFKKPLHRWSFMKKNKALLDKTEHALHQHSMFTILVGRFVG
PTRPLVPMVAGMLDLPVAKFVVPNIIGCVFWPPFYFLPGILVGAAIDIPDGMQSGEFKLL
LLGTAVLLWLAAWLCWRLWRSGKASVDRLTRYLPRSRLLWLAPLTLGVAVVALVALIRHP
LMPVYGEILLKVVSR