Protein Info for EX28DRAFT_3610 in Enterobacter asburiae PDN3

Annotation: Inner membrane protein involved in colicin E2 resistance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 296 to 316 (21 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 350 to 368 (19 residues), see Phobius details amino acids 379 to 396 (18 residues), see Phobius details amino acids 402 to 421 (20 residues), see Phobius details PF06123: CreD" amino acids 6 to 427 (422 residues), 464.7 bits, see alignment E=1.6e-143

Best Hits

Swiss-Prot: 62% identical to CRED_ECOLI: Inner membrane protein CreD (creD) from Escherichia coli (strain K12)

KEGG orthology group: K06143, inner membrane protein (inferred from 79% identity to ent:Ent638_0561)

Predicted SEED Role

"Inner membrane protein CreD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>EX28DRAFT_3610 Inner membrane protein involved in colicin E2 resistance (Enterobacter asburiae PDN3)
MMKSPLFWKVSTLLGCILLLLVPLFMVSNLISERESYRNDVENTLRQSTSGPQKLVGPMI
AIPMTEIFYKIEDEKKVEYKKSYMHFILPESLVVEGNQRVESRNIGIYDGQIWNTDLKIK
AQFNTEELKQLKGETIATGQPFIVTGVGDARGIGTVSISKINGETLSVEPGSGVYGALAG
IHIPLTDKALEAKTFALEMSLSLAGTGSFAVVPVGRNSEMTLTSNWPHPGFMGDYLPVKH
QIGESGFQANWQSSWFANNLESWFYDKESPEWEALPAFSVTVATPADQYQLTDRAIKYAI
LLIALTFMAFFVFETLTGLRLHPMQYLLVGLSLVLFYLVLLALSEHVGFTPAWVVASLVG
AAMNGMYLQAVLKSWKRSGLFVLALLGLDVVMWFLLRSEDSALLLGSAVLALALFAVMYL
TRHFDWYSLSQPKRPQPPAAPDDDTMRIWK