Protein Info for EX28DRAFT_3595 in Enterobacter asburiae PDN3

Annotation: Uncharacterized membrane protein affecting hemolysin expression

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10144: SMP_2
  • amino acids 1 to 160 (160 residues), 212.2 bits, E=1.7e-67

Best Hits

Swiss-Prot: 87% identical to SMP_SHIFL: Protein Smp (smp) from Shigella flexneri

KEGG orthology group: K07186, membrane protein (inferred from 96% identity to enc:ECL_00798)

Predicted SEED Role

"Lipoate-protein ligase A" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate salvage I (1/2 steps found)
• lipoate salvage II (1/4 steps found)

Protein Sequence (214 amino acids)

>EX28DRAFT_3595 Uncharacterized membrane protein affecting hemolysin expression (Enterobacter asburiae PDN3)
MARAKLKFRLHRAVIVLSCLALLVVLMQGASWFSQNHQRQRNPQFEELARTLARQVTLNV
APSMRTETPDEKRIGQVLRLLTENSRILDAGVYDEQGNLIARAGEHVDVRDRLALDGKKA
GGYFNQQIVEPIQGKNGPLGYLRLTLDTHTLPTEAKQVDNTTNILRLMLLLSLAIGVVLA
RTLLRGKRSRWQQSPFLLTASKSVPEDEESEKKD