Protein Info for EX28DRAFT_3584 in Enterobacter asburiae PDN3

Annotation: Predicted periplasmic or secreted lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04972: BON
  • amino acids 59 to 126 (68 residues), 71.9 bits, E=2.2e-24
  • amino acids 139 to 204 (66 residues), 70.9 bits, E=4.5e-24

Best Hits

Swiss-Prot: 80% identical to OSMY_ECOL6: Osmotically-inducible protein Y (osmY) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04065, hyperosmotically inducible periplasmic protein (inferred from 95% identity to enc:ECL_00787)

Predicted SEED Role

"Osmotically inducible protein OsmY"

Protein Sequence (205 amino acids)

>EX28DRAFT_3584 Predicted periplasmic or secreted lipoprotein (Enterobacter asburiae PDN3)
MNMTRLKISKTLLAVTLGSVLVSGSALAESTTMDKAQSTADTAGQKIDSSMNKVGNFMDD
SSITAKVKAALVDDESIKSTDISVKTDKKVVTLSGFVESQAQAEQAVKVAKGVEGVASVS
DKLHVRDGKNASVKGYAGDAATTSEIKAKLLADDLVPSRKVKVETTDGVVQLSGTVDSQA
QSERAESIAKAIDGVKSVKNDLKTK