Protein Info for EX28DRAFT_3568 in Enterobacter asburiae PDN3

Annotation: Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00196: GerE" amino acids 154 to 206 (53 residues), 31.5 bits, see alignment E=5.7e-12

Best Hits

Swiss-Prot: 60% identical to YJJQ_ECO57: Uncharacterized protein YjjQ (yjjQ) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 84% identity to enc:ECL_00775)

Predicted SEED Role

"Putative regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>EX28DRAFT_3568 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain (Enterobacter asburiae PDN3)
MLSLHGKHSVIISRIPVMQNGLGGVMTRHFPDFELTYCSSLQELTLLQLRRADVIIADIS
GEYWNPRGALEEYFSLLNQYRNIHWIFLVSRPLNPIAVELLVRPESTLLSDIEPIEGLVN
AIRAGSERAERVSQALLTPEPQSTGEEDEQVIALTHSERKVLRLLGKGWGINQIATLLKK
SNKTVSAQKNSAMRRLSLRSNADMYAWINSTQGMRELSLMSAYGEFEEWKKPIQQDISPS
SKFAR