Protein Info for EX28DRAFT_3542 in Enterobacter asburiae PDN3

Annotation: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 TIGR02311: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase" amino acids 3 to 250 (248 residues), 426.2 bits, see alignment E=1.9e-132 PF03328: HpcH_HpaI" amino acids 15 to 240 (226 residues), 189.2 bits, see alignment E=3.4e-60

Best Hits

Swiss-Prot: 90% identical to HPCH_KLEP7: 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (hpcH) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_10330)

MetaCyc: 92% identical to 4-hydroxy-2-ketopimelate aldolase monomer (Escherichia coli C)
4-HYDROXY-2-KETOPIMELATE-LYSIS-RXN [EC: 4.1.2.52]

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.52 or 4.1.2.n4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>EX28DRAFT_3542 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (Enterobacter asburiae PDN3)
MQNAFKAALQAGRPQIGLWLGLTSSYSAELLAGAGFDWLLIDGEHAPNSVQTVLTQLQAI
APYPSQPVVRPSWNDPVQIKQLLDVGAQTLLVPMVQNADEARLAVRATRYPPAGIRGVGS
ALARASRWNRIPDYLLQANDAMCVLVQIETREALKNLPQILDVEGVDGVFIGPADLSADM
GFAGNPQHPEVQAAIEQAIAQILSAGKAPGILMANEPLAKRYLELGALFVAVGVDTTLLA
RGAEALAARFIEQPVTSVNNNKSVY