Protein Info for EX28DRAFT_3509 in Enterobacter asburiae PDN3

Annotation: Protease subunit of ATP-dependent Clp proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 89 to 108 (20 residues), see Phobius details PF00574: CLP_protease" amino acids 22 to 192 (171 residues), 220.4 bits, see alignment E=8.7e-70

Best Hits

Swiss-Prot: 61% identical to CLPP3_RHIEC: ATP-dependent Clp protease proteolytic subunit 3 (clpP3) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 91% identity to ent:Ent638_0489)

MetaCyc: 44% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>EX28DRAFT_3509 Protease subunit of ATP-dependent Clp proteases (Enterobacter asburiae PDN3)
MHYTLKESDKEKAEGSNGAGALQQKLLESRSIVISGEINQELAQKVITQMILLQSVSNDP
IKLYINSQGGHVEAGDTIHDFIKFIRPEVHVIGTGWVASAGITIFLAAKKEHRYSLPNTR
FMIHQPLGGVRGQATDIEIEAREIIRMLDRVNKLIADATGQPLEKVKKDTDRNFWMSPAE
ALDYGIVGKLITHYDELKLD