Protein Info for EX28DRAFT_3496 in Enterobacter asburiae PDN3

Annotation: Alpha/beta hydrolase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 2 to 47 (46 residues), 29.6 bits, E=8.8e-11
• PF01738: DLH
  • amino acids 3 to 57 (55 residues), 29 bits, E=1.5e-10
• PF00326: Peptidase_S9
  • amino acids 4 to 64 (61 residues), 29.5 bits, E=1.1e-10
• PF08386: Abhydrolase_4
  • amino acids 5 to 62 (58 residues), 22.4 bits, E=2.2e-08

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Protein Sequence (66 amino acids)

>EX28DRAFT_3496 Alpha/beta hydrolase family (Enterobacter asburiae PDN3)
MAKFDVPTLVIHGSNDQIVPFESTGKLAAEMIKNATLKVYDNAPHGFALTHQDQLNEDLL
AFVKSL