Protein Info for EX28DRAFT_3448 in Enterobacter asburiae PDN3

Annotation: transcriptional regulator, ArgR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF01316: Arg_repressor" amino acids 20 to 79 (60 residues), 48.8 bits, see alignment E=4.8e-17 PF02863: Arg_repressor_C" amino acids 91 to 155 (65 residues), 46.8 bits, see alignment E=2.2e-16

Best Hits

Swiss-Prot: 31% identical to ARGR_COLP3: Arginine repressor (argR) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_00667)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>EX28DRAFT_3448 transcriptional regulator, ArgR family (Enterobacter asburiae PDN3)
MGTMMDYEEYSPKEQLQLTVCQRLIAEKSYLSQEEIRRDLQERGFETISQSTVSRLLKLL
GVIKIRNAKGLKIYSLNPQLRPAPDAARTVSEMVVSVEHNSEFILVHTVAGYGRAVARIL
DYHQLPEILGVVAGSSIVWVAPRVVKRTALVHKQINYLLRTH