Protein Info for EX28DRAFT_3436 in Enterobacter asburiae PDN3

Annotation: anaerobic ribonucleoside-triphosphate reductase activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR02491: anaerobic ribonucleoside-triphosphate reductase activating protein" amino acids 2 to 153 (152 residues), 214.7 bits, see alignment E=3.1e-68 PF13353: Fer4_12" amino acids 12 to 151 (140 residues), 185.3 bits, see alignment E=3.3e-59

Best Hits

Swiss-Prot: 92% identical to NRDG_ECO57: Anaerobic ribonucleoside-triphosphate reductase-activating protein (nrdG) from Escherichia coli O157:H7

KEGG orthology group: K04068, anaerobic ribonucleoside-triphosphate reductase activating protein [EC: 1.97.1.4] (inferred from 97% identity to enc:ECL_00655)

MetaCyc: 92% identical to anaerobic ribonucleoside-triphosphate reductase activating protein (Escherichia coli K-12 substr. MG1655)
1.97.1.-

Predicted SEED Role

"Ribonucleotide reductase of class III (anaerobic), activating protein (EC 1.97.1.4)" in subsystem Ribonucleotide reduction (EC 1.97.1.4)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>EX28DRAFT_3436 anaerobic ribonucleoside-triphosphate reductase activating protein (Enterobacter asburiae PDN3)
MRYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRLNSGMPFTAEMEDRIVNDLN
DTRIKRQGISLSGGDPLHPQNVPDILKLVKRIRRECAGKDIWVWTGYKLDELNAQQMEVV
DLINVLVDGKFVQDLKDPALIWRGSSNQVVHHLR