Protein Info for EX28DRAFT_3433 in Enterobacter asburiae PDN3

Annotation: Transcriptional antiterminator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 PF08279: HTH_11" amino acids 7 to 63 (57 residues), 40.3 bits, see alignment 6.9e-14 PF05043: Mga" amino acids 91 to 165 (75 residues), 30 bits, see alignment E=1.9e-10 PF00874: PRD" amino acids 196 to 277 (82 residues), 24.6 bits, see alignment E=7.7e-09 amino acids 300 to 386 (87 residues), 66.6 bits, see alignment E=6.2e-22 PF00359: PTS_EIIA_2" amino acids 497 to 622 (126 residues), 56.7 bits, see alignment E=8.1e-19

Best Hits

KEGG orthology group: None (inferred from 90% identity to ent:Ent638_0433)

Predicted SEED Role

"Putative BglB-family transcriptional antiterminator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (636 amino acids)

>EX28DRAFT_3433 Transcriptional antiterminator (Enterobacter asburiae PDN3)
MRFPNQRLAQLFDLLQNETLPQDELAQRLSVSTRTVRADITALNALLAGHGAQFILSRGN
GYQLKIDDAQRYQQLQASHPRALRIPRTGPERVHYLVVRFLTSAFSLKLEDLADEWFVSR
ATLQSDMAEVREWFHRYNLTLETRPRHGMKLFGSEMSTRACLTDLLWELAQQDSLNPLVT
DVALNAGVAEQMVPVLHEALTRHHIRLTDEGELFLRLYCAVSVRRISEGYPLPEFHAEDV
EENVREAAKDIAVTIQQLAGKALSPSEESWLCVHIAARQIQEIAPSAINADDDEALVNYI
LRYINTHYNYNLLSDAQLHADLLTHIKTMITRVRYQIMIPNPLLDNIKQHYPMAWDMTLA
AVSSWGKYTPYVISENEIGFLVLHIGVGLERHYNIGYQRQPRVLLVCDAGNAMARMIEAV
LQRKYPQIEVTRTLTLREYELTESISEDFVIATARVSEKSKPVVTIAPFPTDYQLEQIGK
LVLVDRTRPWMLDKYFDAAHFRILDKPVDQQTLFRELCAQLEGEGFVGAEFLDSVVEREA
IVSTMLGDGIALPHSLGLLAQKTVVYTVLAPHGVQWGDETAHVIFLLAISKSEYEEAMAI
YDIFVTFLRERAMSRLCSCGDFAGFKAVAMESLSRF