Protein Info for EX28DRAFT_3429 in Enterobacter asburiae PDN3

Annotation: probable amidohydrolase EF_0837/AHA_3915

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03583: putative amidohydrolase, EF_0837/AHA_3915 family
  • amino acids 3 to 364 (362 residues), 576.7 bits, E=1e-177
• PF01979: Amidohydro_1
  • amino acids 47 to 336 (290 residues), 33.1 bits, E=1.8e-12

Best Hits

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 97% identity to enc:ECL_00647)

Predicted SEED Role

"Metallo-dependent hydrolases, subgroup B"

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Protein Sequence (377 amino acids)

>EX28DRAFT_3429 probable amidohydrolase EF_0837/AHA_3915 (Enterobacter asburiae PDN3)
MFDLLLRRARLADDTLTDIAIQDGKIAALGDIDAPAHKTVELNGDVFVSAGWIDSHVHCY
PNSPIYHDEPDSVGIATGVTSVVDAGSTGADDVDDFYDITRRASTEVFALLNISRVGLIA
QNELANMANIDADAVTQAVKRHPDFIVGLKARMSSSVVGENGITPLERAKAIQKENGDLP
LMVHIGNNPPNLDEIAELLSSGDIITHCYNGKPNRILTPSGELRASITSALKRGVRLDVG
HGTASFSFEVAKRAIAMGILPHTISSDIYCRNRINGPVGSLASVMSKFLAIGMSLPQVID
CVTANAADGLRLSHKGRIQPGLDADLTLFTLKRQPTVLTDAENDSLQAEHILVPLAAIRA
GKGYMTEQGSTEHAFDL