Protein Info for EX28DRAFT_3419 in Enterobacter asburiae PDN3
Annotation: Fructose-1,6-bisphosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 96% identical to F16PA_ECOLC: Fructose-1,6-bisphosphatase class 1 (fbp) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 98% identity to enc:ECL_00637)MetaCyc: 96% identical to fructose-1,6-bisphosphatase 1 (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphatase. [EC: 3.1.3.11]
Predicted SEED Role
"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
- gluconeogenesis I (13/13 steps found)
- glycolysis I (from glucose 6-phosphate) (13/13 steps found)
- superpathway of anaerobic sucrose degradation (17/19 steps found)
- superpathway of N-acetylneuraminate degradation (19/22 steps found)
- glycolysis II (from fructose 6-phosphate) (11/11 steps found)
- superpathway of hexitol degradation (bacteria) (16/18 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- oxygenic photosynthesis (11/17 steps found)
KEGG Metabolic Maps
- Biosynthesis of phenylpropanoids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 3.1.3.11
Use Curated BLAST to search for 3.1.3.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (332 amino acids)
>EX28DRAFT_3419 Fructose-1,6-bisphosphatase (Enterobacter asburiae PDN3) MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAGLVDILGASGAENVQGE VQQKLDLFANEKLKAALRARDIVAGIASEEEDEIVVFEGCEHAKYVVLMDPLDGSSNIDV NVSVGTIFSIYRRVTPVGTPVTEEDFLQPGVNQVAAGYVVYGSSTMLVYTTGCGVHAFTY DPSLGVFCLSQERMRFPEKGNTYSINEGNYIRFPNGVKKYIKFCQEEDKATQRPYTSRYI GSLVADFHRNLLKGGIYLYPSTASHPDGKLRLLYECNPMAFLAEQAGGKASDGKERILDI VPESLHQRRSFFVGNNHMVEDVERFIREYPDA