Protein Info for EX28DRAFT_3397 in Enterobacter asburiae PDN3

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00109: ketoacyl-synt
  • amino acids 182 to 369 (188 residues), 53.1 bits, E=3.6e-18
• PF02801: Ketoacyl-synt_C
  • amino acids 383 to 495 (113 residues), 33.6 bits, E=3.6e-12

Best Hits

Swiss-Prot: 54% identical to FABY_PSEAE: Beta-ketoacyl-[acyl-carrier-protein] synthase FabY (fabY) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 90% identity to enc:ECL_00608)

MetaCyc: 54% identical to beta-ketoacyl-[acyl-carrier-protein] synthase (Pseudomonas aeruginosa PAO1)
Beta-ketoacyl-acyl-carrier-protein synthase III. [EC: 2.3.1.180]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
• biotin biosynthesis I (15/15 steps found)
• 8-amino-7-oxononanoate biosynthesis I (11/11 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• superpathway of fatty acid biosynthesis initiation (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• fatty acid biosynthesis initiation (mitochondria) (3/4 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• petroselinate biosynthesis (2/6 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.179, 2.3.1.180

Use Curated BLAST to search for 2.3.1.179 or 2.3.1.180

Protein Sequence (632 amino acids)

>EX28DRAFT_3397 3-oxoacyl-(acyl-carrier-protein) synthase (Enterobacter asburiae PDN3)
MVKLPVITAFGGYGPAGRSSSHHAFRRMIIESLSEEERQETLLSLAILMGALKYDESGYR
DISGKIFTPAQAAARIKDEALEGTLIRKITRDYFDVDAIASHAKLNMVSGEEGLSFNISA
RQLPQPLPAGWHVEELADRRVRITVQGEMDCKIEALLRTEVQAAGLLPQGFRPGDHYNSQ
FHPRALQMAIVGASDAINALGIPWREVQAKITPDQLGVYSGNIMGQLDDYGFGGMLQSRL
KGHRVSAKQCPLGLNSMCADFLNAYVLGSVGHTSATLGACATFLYNLHAAVEDIKAGRIR
VAVVGSAEAPVTSEVIEGFDAMGALATESKLKHIDETETADWRNSSRPFGNSCGFVIAES
SQYVVLMDDELALQLGAEIHGSVGNVFINADGFKRSIASPGPGNYITMAKAVASAVSMAG
IETVQKGSFIQAHGSSTPKNCVSEADIFDRVAQAFSIRDWPVTAVKSYLGHSLGPASGDQ
LISCLGVFRYGILPGIKSVSHIAPQVNNARLTIPLQDCKLEEDQGQIAFINSKGFGGNNA
TGVVYSPKLTHQWLRKRYGEAVFAEYQQRNRQVRRQANAYDQAASQGELNVIYLFGQQGI
NEEDIKIDMNGITIPGFEKPITYATDKEYPDF