Protein Info for EX28DRAFT_3375 in Enterobacter asburiae PDN3

Annotation: transcriptional regulator, BadM/Rrf2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR00738: Rrf2 family protein" amino acids 1 to 128 (128 residues), 124.3 bits, see alignment E=1.5e-40 PF02082: Rrf2" amino acids 3 to 130 (128 residues), 128.7 bits, see alignment E=8.2e-42

Best Hits

Swiss-Prot: 96% identical to NSRR_ENT38: HTH-type transcriptional repressor NsrR (nsrR) from Enterobacter sp. (strain 638)

KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 94% identity to eco:b4178)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>EX28DRAFT_3375 transcriptional regulator, BadM/Rrf2 family (Enterobacter asburiae PDN3)
MQLTSFTDYGLRALIYMASLPEGKMTSISEVTEVYGVSRNHMVKIINQLSRAGYVAAVRG
KNGGIRLGKPAQSIRVGDVVRELEPLSLVNCSSEFCHITPACRLKKALSKAVQSFLMELD
NYTLADLVEENQPLYKLLLVE