Protein Info for EX28DRAFT_3371 in Enterobacter asburiae PDN3

Annotation: HflK protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12221: HflK_N
  • amino acids 1 to 59 (59 residues), 60.8 bits, E=9.4e-21
• TIGR01933: HflK protein
  • amino acids 96 to 356 (261 residues), 415.3 bits, E=5e-129
• PF01145: Band_7
  • amino acids 98 to 269 (172 residues), 118 bits, E=5.1e-38

Best Hits

Swiss-Prot: 88% identical to HFLK_ECO57: Protein HflK (hflK) from Escherichia coli O157:H7

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 94% identity to esc:Entcl_3984)

MetaCyc: 88% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (419 amino acids)

>EX28DRAFT_3371 HflK protein (Enterobacter asburiae PDN3)
MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGREQGPPDLDDIFRKLSKKLGGLGGGKG
SGSGGNSTQSSRPPMGGRVVGIVAAAVVIIWAASGFYTIKEAERGVVTRFGKFSHLVEPG
LNWKPTFIDDVTAVNVESVRELAASGVMLTSDENVVRVEMNVQYRVTDPERYLFSVTSAD
DSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYNMGITLLDVNFQAA
RPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKTQTILEA
QGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRKVLVNDSKGGNLMVLPLDQMLK
GGSAPAAKGDTSGANNLLRLPPASSGSASTNTTPSSNDGDIMDQRRANAQRNDYQRQGE