Protein Info for EX28DRAFT_3356 in Enterobacter asburiae PDN3

Annotation: EF-P lysine aminoacylase GenX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF00152: tRNA-synt_2" amino acids 15 to 322 (308 residues), 176.8 bits, see alignment E=3e-56 TIGR00462: EF-P lysine aminoacylase GenX" amino acids 17 to 320 (304 residues), 444.7 bits, see alignment E=9.4e-138

Best Hits

Swiss-Prot: 96% identical to EPMA_ENT38: Elongation factor P--(R)-beta-lysine ligase (epmA) from Enterobacter sp. (strain 638)

KEGG orthology group: K04568, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 98% identity to enc:ECL_00559)

MetaCyc: 93% identical to EF-P-lysine lysyltransferase (Escherichia coli K-12 substr. MG1655)
6.3.2.-

Predicted SEED Role

"Translation elongation factor P Lys34:lysine transferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.6

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>EX28DRAFT_3356 EF-P lysine aminoacylase GenX (Enterobacter asburiae PDN3)
MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRF
VGPGHSQGMNMYLMTSPEYHMKRLLAAGCGPVYQLCRSFRNEEMGRHHNPEFTMLEWYRP
HYDMYRLMNEVDDLLQQVLDCSEAETLSYQQAFQRHLEIDPLSADKTQLREVAAKLDLSN
VADTEEDRDTLLQLLFTFGVEPQIGKDRPTFVYHFPASQASLAQISTEDHRVAERFEVYY
KGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDVNLLEALKAGLPDCSGVALG
VDRLVMLALGAEQLGDVIAFTVDRA