Protein Info for EX28DRAFT_3331 in Enterobacter asburiae PDN3

Annotation: Putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details transmembrane" amino acids 15 to 24 (10 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details PF01810: LysE" amino acids 13 to 187 (175 residues), 53.8 bits, see alignment E=9e-19

Best Hits

KEGG orthology group: None (inferred from 81% identity to pwa:Pecwa_0720)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>EX28DRAFT_3331 Putative threonine efflux protein (Enterobacter asburiae PDN3)
MSLIPFLLFAFVASITPGPTNILVLTNSQHFGVKNTVPAILGGCIAASAIVLVSGAGAGE
VLRQYPLIRQIMSWAGVLWLSWMSWQLFRAPAARLSAENRIRFTARAAALLQIVNPKTWM
MALTVVSLFAPTGDHALRDIALMALWFLLISIACLMCWAWLGKAVNRIFRTTVAMVRFQR
LMALCLLVSAWAGMLA