Protein Info for EX28DRAFT_3313 in Enterobacter asburiae PDN3

Annotation: putative TIM-barrel protein, nifR3 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 3 to 319 (317 residues), 456.6 bits, see alignment E=2.2e-141 PF01207: Dus" amino acids 14 to 319 (306 residues), 394.8 bits, see alignment E=2.7e-122

Best Hits

Swiss-Prot: 95% identical to DUSB_KLEPN: tRNA-dihydrouridine synthase B (dusB) from Klebsiella pneumoniae

KEGG orthology group: K05540, tRNA-dihydrouridine synthase B [EC: 1.-.-.-] (inferred from 98% identity to enc:ECL_04645)

MetaCyc: 94% identical to tRNA-dihydrouridine synthase B (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>EX28DRAFT_3313 putative TIM-barrel protein, nifR3 family (Enterobacter asburiae PDN3)
MRIGHHQLRNRLIAAPMAGITDRPFRTLCYEMGAGLTVSEMMSSNPQVWESDKSRLRMVH
VDEPGIRTVQIAGSVPEEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDQ
VKAILTAVVSAVDVPVTLKIRTGWSPVHRNCVEIAQLAEDCGIQALTIHGRTRACLFNGE
AEYDSIRAVKQKVSIPIIANGDITDPLKARAVLDYTGADALMIGRAAQGRPWIFREIQHY
LDTGELLAPLPLAEVKRLLCSHVRELHDHYGQAKGYRIARKHVSWYLQEHAPDDQFRRTF
NAIEDASVQLEALEAYFENLA