Protein Info for EX28DRAFT_3305 in Enterobacter asburiae PDN3

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details PF01794: Ferric_reduct" amino acids 47 to 161 (115 residues), 61.7 bits, see alignment E=3.7e-21

Best Hits

Swiss-Prot: 90% identical to MSRQ_ENT38: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_04638)

MetaCyc: 83% identical to membrane-bound flavocytochrome MsrQ (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>EX28DRAFT_3305 Predicted membrane protein (Enterobacter asburiae PDN3)
MRLTAKQITWLKMLLHLAGLLPFIWLFWAASQGLFSADPAKDIQHFTGRMALKFLLATLL
VSPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGINNLALLGRELVTRPYLTL
GIVSWVVLLALALTSTQYAQRKLGRRWQLLHNFVYLVAILAPIHYLWSVKILSPQPILYA
LAAVALLAWRYKKFRQWLR