Protein Info for EX28DRAFT_3292 in Enterobacter asburiae PDN3

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 46 to 243 (198 residues), 113.1 bits, see alignment E=6.9e-37 PF25973: BSH_CzcB" amino acids 47 to 182 (136 residues), 31.9 bits, see alignment E=2e-11 PF25917: BSH_RND" amino acids 47 to 187 (141 residues), 50.2 bits, see alignment E=3.8e-17 PF25878: HH_AAEA_pHBA" amino acids 81 to 153 (73 residues), 132.1 bits, see alignment E=1.7e-42 PF25963: Beta-barrel_AAEA" amino acids 190 to 286 (97 residues), 160.7 bits, see alignment E=1.6e-51

Best Hits

Swiss-Prot: 93% identical to AAEA_SALPK: p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: None (inferred from 99% identity to enc:ECL_04624)

MetaCyc: 89% identical to aromatic carboxylic acid efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-233

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>EX28DRAFT_3292 RND family efflux transporter, MFP subunit (Enterobacter asburiae PDN3)
MKTLTRKISRTAITMALVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITA
VNVHDNQLVKKDQVLFTIDQPRYQKALEEAEADVAYYQALAAEKRREAGRRNQLGVQAMS
REEIDQSNNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPSDGWVTNLNVYAGEFITRGS
TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNRVFKGTVDSVAAGVTNSSSSN
DAKGMATVDSNLEWVRLAQRVPVRIHLDEQQGNLWPAGTTATVVITGEKDRDASQDSFFR
KIAHRLREFG