Protein Info for EX28DRAFT_3273 in Enterobacter asburiae PDN3

Annotation: Predicted ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF05872: HerA_C" amino acids 6 to 500 (495 residues), 832.5 bits, see alignment E=3.2e-254 PF01935: DUF87" amino acids 20 to 197 (178 residues), 30.2 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 93% identical to YJGR_ECOLI: Uncharacterized protein YjgR (yjgR) from Escherichia coli (strain K12)

KEGG orthology group: K06915, (no description) (inferred from 98% identity to enc:ECL_04600)

Predicted SEED Role

"FIG00638157: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>EX28DRAFT_3273 Predicted ATPase (Enterobacter asburiae PDN3)
MSTPLLIARTLEKELYLLPAMANRHGLITGATGTGKTVTLQKLAESLSEIGVPVFMADVK
GDLTGVAQEGTASEKLLERLKNIGITDWTPHNNPVVVWDIFGEKGHPVRATVSDLGPLLL
ARLLNLNDVQSGVLNIIFRIADDQGLLLLDFKDLRAITQYIGDNAKSFQNQYGNISSASV
GAIQRGLLTLEQQGAEHFFGEPMLDIKDWMRTDSSGKGIINILSSEKLYQMPKLYAASLL
WMLSELYEQLPEAGDLEKPKLVFFFDEAHLLFSDAPQVLLDKIEQVIRLIRSKGVGVWFV
SQNPSDIPDNVLGQLGNRVQHALRAFTPKDQKAVKAAAQTMRANPAFDTEAAIQALGTGE
ALISFLDAKGSPSVVERAMVIAPCSRMGPVTDDERNGLINHSPVYGKYEDEVDRESAFEM
LQKGVQATTESQDAPAAKGQSVAVDDGILGGLKDILFGSTGPRGGKRDGVVQTMAKSAAR
QVTNQIVRGMLGSLLGGRRR