Protein Info for EX28DRAFT_3265 in Enterobacter asburiae PDN3

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 6 to 358 (353 residues), 458.4 bits, see alignment E=5.9e-142 PF03739: LptF_LptG" amino acids 9 to 358 (350 residues), 282.2 bits, see alignment E=3.1e-88

Best Hits

Swiss-Prot: 94% identical to LPTG_ECOLI: Lipopolysaccharide export system permease protein LptG (lptG) from Escherichia coli (strain K12)

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 97% identity to enc:ECL_04592)

MetaCyc: 94% identical to lipopolysaccharide transport system protein LptG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"FIG000906: Predicted Permease"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>EX28DRAFT_3265 Predicted permeases (Enterobacter asburiae PDN3)
MQAFGVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGSYDAMGAGMYTLLSV
PKDVQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRMQVALSVMKTAIPLVLLTMAI
GEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGKNFVYIERVKGNDELGGVSIYAF
DDQRRLESVRHASSAKFDAEHKQWRLSQVDESDLTDPKQIAGSQTVTGTWKTNLTPDKLG
VVALDPDALSISGLHNYVKYLKSSGQDAGRYQLNMWSKIFQPMSVAVMMLMALSFIFGPL
RSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPIIGALLPSASFLLISLWLLLKRS