Protein Info for EX28DRAFT_3254 in Enterobacter asburiae PDN3

Annotation: lipopolysaccharide transport periplasmic protein LptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03002: lipopolysaccharide transport periplasmic protein LptA
  • amino acids 28 to 166 (139 residues), 172.3 bits, E=2.7e-55
• PF03968: LptD_N
  • amino acids 37 to 149 (113 residues), 116.5 bits, E=3.8e-38

Best Hits

Swiss-Prot: 85% identical to LPTA_ECOLI: Lipopolysaccharide export system protein LptA (lptA) from Escherichia coli (strain K12)

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 98% identity to enc:ECL_04582)

MetaCyc: 89% identical to LPS export ABC transporter substrate-binding protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Protein Sequence (184 amino acids)

>EX28DRAFT_3254 lipopolysaccharide transport periplasmic protein LptA (Enterobacter asburiae PDN3)
MKFKTNKLSLKVIIASAMLATSLPALAVTGDTDQPIHIESDTQSLDMQGNVVTFTGNVVM
TQGTIKINADKVVVTRPGGEQGKEIIDGYGNPATFYQMQDNGKPVKGHASHMHYELAKDL
VILTGNAYLEQLDSNITGDQITYLVKEQKMQASSEKGKRVTTVLVPSQLQDKGKGQAPAQ
KKSN