Protein Info for EX28DRAFT_3240 in Enterobacter asburiae PDN3

Annotation: ribosomal protein L21

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 PF00829: Ribosomal_L21p" amino acids 1 to 101 (101 residues), 125.2 bits, see alignment E=5.3e-41 TIGR00061: ribosomal protein bL21" amino acids 2 to 101 (100 residues), 150.2 bits, see alignment E=9.8e-49

Best Hits

Swiss-Prot: 99% identical to RL21_ECO24: 50S ribosomal protein L21 (rplU) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K02888, large subunit ribosomal protein L21 (inferred from 99% identity to eco:b3186)

MetaCyc: 99% identical to 50S ribosomal subunit protein L21 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L21p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>EX28DRAFT_3240 ribosomal protein L21 (Enterobacter asburiae PDN3)
MYAVFQSGGKQHRVSEGQTVRLEKLDIATGESVEFAEVLMIANGEEVKIGVPFVDGGVIK
AEVVAHGRGEKVKIVKFRRRKHYRKQQGHRQWFTDVKITGISA