Protein Info for EX28DRAFT_3236 in Enterobacter asburiae PDN3

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details PF26769: HAMP_PhoQ" amino acids 87 to 131 (45 residues), 28.3 bits, see alignment 2.1e-10 PF00512: HisKA" amino acids 137 to 194 (58 residues), 45.3 bits, see alignment E=1.1e-15 PF02518: HATPase_c" amino acids 238 to 345 (108 residues), 83.3 bits, see alignment E=2.6e-27

Best Hits

KEGG orthology group: K07643, two-component system, OmpR family, sensor histidine kinase BasS [EC: 2.7.13.3] (inferred from 94% identity to enc:ECL_04563)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>EX28DRAFT_3236 Signal transduction histidine kinase (Enterobacter asburiae PDN3)
MNSMRRRLMVLLAVILLFFQLISVIWLWHESREQIGFLVNETLSAKARNNHVEKEIREAI
ASLLVPSLVMVGFTLLFSFWAVTWITRPLNKLRDSLANRSADNLTPLPMYSDMEEIGAVT
TSLNQLLARLDNTIQQERLFTADAAHELRTPLAGIRLHLELMAQSGAPQAATLISRIDQL
MHTVEQLLMLARAGQAMASGHYETVSWTENIIEPLGLGHEAKEHTVIWPAKSALTVQGDA
VLLRLMLRNLLENAGRYSPAGTTITVTLTEIDGGTQIGVIDQGPGIDEAHRQSITEPFRR
LDQRYGGSGLGLSIVQRIVQLHHGRLTLENGAEGGLIASCWLPATLE