Protein Info for EX28DRAFT_3234 in Enterobacter asburiae PDN3

Annotation: D-alanyl-D-alanine carboxypeptidase, serine-type, PBP4 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02113: Peptidase_S13" amino acids 20 to 468 (449 residues), 562.5 bits, see alignment E=6.7e-173 TIGR00666: D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase" amino acids 47 to 447 (401 residues), 582.6 bits, see alignment E=1.7e-179 PF13354: Beta-lactamase2" amino acids 284 to 442 (159 residues), 24.6 bits, see alignment E=1.5e-09

Best Hits

Swiss-Prot: 91% identical to DACB_ECOLI: D-alanyl-D-alanine carboxypeptidase DacB (dacB) from Escherichia coli (strain K12)

KEGG orthology group: K07259, D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase (penicillin-binding protein 4) [EC: 3.4.16.4 3.4.21.-] (inferred from 96% identity to ent:Ent638_3616)

MetaCyc: 91% identical to peptidoglycan DD-endopeptidase DacB (Escherichia coli K-12 substr. MG1655)
Serine-type D-Ala-D-Ala carboxypeptidase. [EC: 3.4.16.4]; 3.4.-.- [EC: 3.4.16.4]

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4, 3.4.21.-

Use Curated BLAST to search for 3.4.16.4 or 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>EX28DRAFT_3234 D-alanyl-D-alanine carboxypeptidase, serine-type, PBP4 family (Enterobacter asburiae PDN3)
MRFSRFIIGLTTSITFTAQAANVDEYINQLPAGANLALMVQKVGAQAPEIDYHSQQMALP
ASTQKVITALAALLQLGPDFRFTTTLETKGNVEGGVLKGDLIARFGGDPTFKRQDIRNMV
AVLKKSGVQKIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYS
APKPDDLAFIRIASYYPVTMFSQVRTLAKGSPDAQYCELDVVPGDLNRFTLTGCLTQRAD
PLPLAFAIQDGASYAGAILKDELKQAGITYSGTLLRQTQVNQPGTVIASKQSPPLHDLLR
IMLKKSDNMIADTVFRMIGHARFGVPGTWRAGSDAVRQILRQQAGIELGNTIAVDGSGLS
RHNLISPATMMQVLQYIAQHDTELNFISMLPLAGHDGSLQYRAGLHAAGVDGKVSAKTGS
LQGVYNLAGFITTASGQRMAFVQYLSGYAVEPTDQRNRRIPLVRFESRLYKDIYQNN