Protein Info for EX28DRAFT_3229 in Enterobacter asburiae PDN3

Annotation: ATP-dependent metalloprotease FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 101 to 122 (22 residues), see Phobius details PF06480: FtsH_ext" amino acids 8 to 96 (89 residues), 74.7 bits, see alignment E=1.9e-24 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 103 to 596 (494 residues), 820.9 bits, see alignment E=2e-251 PF06068: TIP49" amino acids 156 to 225 (70 residues), 25.7 bits, see alignment E=2e-09 PF07728: AAA_5" amino acids 190 to 312 (123 residues), 26.5 bits, see alignment E=1.7e-09 PF00004: AAA" amino acids 191 to 323 (133 residues), 161.2 bits, see alignment E=5.5e-51 PF17862: AAA_lid_3" amino acids 346 to 390 (45 residues), 44.5 bits, see alignment 2.7e-15 PF01434: Peptidase_M41" amino acids 404 to 594 (191 residues), 246.4 bits, see alignment E=6.5e-77

Best Hits

Swiss-Prot: 98% identical to FTSH_SALTI: ATP-dependent zinc metalloprotease FtsH (ftsH) from Salmonella typhi

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 99% identity to enc:ECL_04557)

MetaCyc: 98% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (647 amino acids)

>EX28DRAFT_3229 ATP-dependent metalloprotease FtsH (Enterobacter asburiae PDN3)
MSDMAKNLILWLVIAVVLMSVFQSFGPSESNGRKVDYSTFLQEVNQDQVREARINGREIN
VTKKDSNRYTTYIPVNDPKLLDNLLTKNVKVVGEPPEEPSLLASIFISWFPMLLLIGVWI
FFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEAKEEVGELVEYLREPSRF
QKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMF
EQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAAT
NRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFS
GADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERRSMVMTEAQKESTAYHEAG
HAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISASRQKLESQISTLYGGRLAEE
IIYGVEHVSTGASNDIKVATNLARNMVTQWGFSDKLGPLLYAEEEGEVFLGRSVAKAKHM
SDETARIIDQEVKSLVERNYARARQILTDNMDILHSMKDALMKYETIDAPQIDDLMARRE
VRPPAGWEDPGASNNSDNNGTPRAPRPVDEPRTPNPGNTMSEQLGDK