Protein Info for EX28DRAFT_3228 in Enterobacter asburiae PDN3

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01496: dihydropteroate synthase
  • amino acids 17 to 271 (255 residues), 342.3 bits, E=1.1e-106
• PF00809: Pterin_bind
  • amino acids 18 to 257 (240 residues), 305.8 bits, E=1.3e-95

Best Hits

Swiss-Prot: 93% identical to DHPS_ECOL6: Dihydropteroate synthase (folP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 96% identity to enc:ECL_04556)

MetaCyc: 93% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• tetrahydrofolate biosynthesis II (2/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Protein Sequence (282 amino acids)

>EX28DRAFT_3228 dihydropteroate synthase (Enterobacter asburiae PDN3)
MKLFAQDSHLDLSHPHVMGILNVTPDSFSDGGTHNTLIEAVKHANLMINAGATIIDVGGE
STRPGAADVSVEEELARVVPVVEAIAQRFEVWISVDTSKPEVIREVARVGAHIINDIRSL
TEPGALEAAAETGLPVCLMHMQGQPKTMQEAPKYDDVFADVNRFFIEHIARCERAGIPKE
KLLLDPGFGFGKNLSHNYALLARLSEFHHFDLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLAAKENKRYE