Protein Info for EX28DRAFT_3219 in Enterobacter asburiae PDN3

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 895 PF04760: IF2_N" amino acids 1 to 52 (52 residues), 41.4 bits, see alignment 4.4e-14 amino acids 319 to 369 (51 residues), 54.4 bits, see alignment 3.9e-18 PF08364: IF2_assoc" amino acids 57 to 95 (39 residues), 59.1 bits, see alignment (E = 1.9e-19) TIGR00487: translation initiation factor IF-2" amino acids 311 to 894 (584 residues), 980.8 bits, see alignment E=2.7e-299 TIGR00231: small GTP-binding protein domain" amino acids 398 to 553 (156 residues), 112.9 bits, see alignment E=1.3e-36 PF00009: GTP_EFTU" amino acids 398 to 554 (157 residues), 129.2 bits, see alignment E=6.5e-41 PF01926: MMR_HSR1" amino acids 399 to 504 (106 residues), 39.8 bits, see alignment E=1.9e-13 PF00071: Ras" amino acids 400 to 555 (156 residues), 23.4 bits, see alignment E=1.8e-08 PF22042: EF-G_D2" amino acids 570 to 649 (80 residues), 96.4 bits, see alignment E=3.9e-31 PF11987: IF-2" amino acids 670 to 784 (115 residues), 145.1 bits, see alignment E=4e-46 PF03144: GTP_EFTU_D2" amino acids 815 to 882 (68 residues), 35.7 bits, see alignment 4.2e-12

Best Hits

Swiss-Prot: 92% identical to IF2_CITK8: Translation initiation factor IF-2 (infB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 97% identity to esc:Entcl_0529)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (895 amino acids)

>EX28DRAFT_3219 translation initiation factor IF-2 (Enterobacter asburiae PDN3)
MTDVTVKSLAAEIQTSVDRLVQQFADAGIPKSADDSVTAQEKQTLLTHLNREHGSTPDKL
TLQRKTRSTLNIPGTGGKSKSVQIEVRKTRTFVKRDPQEAERLAAEEQAQREAEEQAQRE
AEATAKREAELKAEREAAEKAKRDASDKVKRDAAEKDKVSNQQTDEMTKTAQAEKARREN
EAAELKRKAEEEARRKLEEEARRVAEEARRMAEENEKNGVNTVEPTEDTSDYHVTTSQHA
RQAEDDNDREVEGGRGRGRNAKAARPAKKGNKHAESKADREEARAAVRGGKGGKRKGSAL
QQSFQKPAQAVNRDVVIGETITVGDLANKMAVKGSQVIKAMMKLGAMATINQVIDQETAQ
LVAEEMGHKVILRRENELEEAVMSDRDTGAAAEPRAPVVTIMGHVDHGKTSLLDYIRSTK
VASGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTSMRARGAQATDIVVLVVAADDGV
MPQTIEAIQHAKAAQVPLVVAVNKIDKPEADLDRVKNELSQYGVMPEEWGGEAQFIPVSA
KAGTGIDDLLNAILLQAEVLELKAIRNGMASGAVIESFLDKGRGPVATVLVREGTLNKGD
IVLCGFEYGRVRAMRNELGQEVLEAGPSIPVEILGLSGVPAAGDEVTVVRDEKKAREVAL
YRQGKFREVKLARQQKSKLENMFANMTEGEVHEVNIVLKADVQGSVEAISDSLLKLSTDE
VKVKIIGSGVGGITETDATLAAASNAILVGFNVRADASARKVIEAESLDLRYYSVIYNLI
DEVKAAMSGMLSPELKQQIIGLAEVRDVFKSPKFGAIAGCMVTEGNIKRHNPIRVLRDNV
VIYEGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRVGDMIEVFEIIEIQRTIA