Protein Info for EX28DRAFT_3193 in Enterobacter asburiae PDN3

Annotation: class II aldolase, tagatose bisphosphate family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 1 to 283 (283 residues), 365.3 bits, E=2.3e-113
• TIGR01858: class II aldolase, tagatose bisphosphate family
  • amino acids 3 to 283 (281 residues), 527.3 bits, E=7.6e-163
• PF01116: F_bP_aldolase
  • amino acids 5 to 283 (279 residues), 334.3 bits, E=3.4e-104

Best Hits

Swiss-Prot: 94% identical to KBAY_ENT38: D-tagatose-1,6-bisphosphate aldolase subunit KbaY (kbaY) from Enterobacter sp. (strain 638)

KEGG orthology group: K08302, tagatose 1,6-diphosphate aldolase [EC: 4.1.2.40] (inferred from 98% identity to enc:ECL_04526)

MetaCyc: 92% identical to D-tagatose-1,6-bisphosphate aldolase subunit KbaY (Escherichia coli O157:H7)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

"Tagatose 1,6-bisphosphate aldolase (EC 4.1.2.40)" in subsystem D-Tagatose and Galactitol Utilization or Lactose and Galactose Uptake and Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 4.1.2.40)

MetaCyc Pathways

• superpathway of hexitol degradation (bacteria) (16/18 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (4/4 steps found)
• N-acetyl-D-galactosamine degradation (4/5 steps found)
• galactitol degradation (3/5 steps found)
• D-tagatose degradation (1/3 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Galactose metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.40

Use Curated BLAST to search for 4.1.2.40

Protein Sequence (290 amino acids)

>EX28DRAFT_3193 class II aldolase, tagatose bisphosphate family (Enterobacter asburiae PDN3)
MSIISTKYLLQDAQAKGYAVPAFNIHNAETIQAILEACSEMRSPVILAGTPGTFKHIALE
EIYALCSAYSHTYDMPLALHLDHHESLDDIRQKVNAGVRSAMIDGSHYPFEQNVKLVKSV
VDFCHLNDCSVEAELGRLGGMEDDMSVDAESAFLTDPQEAKRFVELTGVDSLAVAIGTAH
GLYTKRPKIDFQRLAEIREVVTVPLVLHGASDVPDEFVRRTIELGVCKVNVATELKIAFS
DAVKAWFAENPQGNDPRFYMRVGMDAMKEVVRSKIAVCGSANRLLLPAEA