Protein Info for EX28DRAFT_3190 in Enterobacter asburiae PDN3

Annotation: Phosphotransferase system, mannose/fructose-specific component IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF03610: EIIA-man" amino acids 3 to 112 (110 residues), 78 bits, see alignment E=3.2e-26

Best Hits

KEGG orthology group: K02744, PTS system, N-acetylgalactosamine-specific IIA component [EC: 2.7.1.69] (inferred from 96% identity to enc:ECL_04523)

MetaCyc: 83% identical to AgaF (Escherichia coli O157:H7)
TRANS-RXN-167 [EC: 2.7.1.193]

Predicted SEED Role

"PTS system, N-acetylgalactosamine- and galactosamine-specific IIA component (EC 2.7.1.69)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.193 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>EX28DRAFT_3190 Phosphotransferase system, mannose/fructose-specific component IIA (Enterobacter asburiae PDN3)
MLGIILTGHGGFASGLEQAMKQILGEQPQFIAIDFPETSTTARLTAQLEQAVNELDAQHD
IVFLTDLLGGTPFRVASTLAMQRPGSEVITGTNLQLLLEMVLERDGLSSEAFRLQALECG
HRGLTSLVDELGRCREEAPAEEGI