Protein Info for EX28DRAFT_3177 in Enterobacter asburiae PDN3

Annotation: serine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 206 to 233 (28 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 422 to 440 (19 residues), see Phobius details TIGR00814: serine transporter" amino acids 17 to 433 (417 residues), 552.1 bits, see alignment E=3.8e-170 PF03222: Trp_Tyr_perm" amino acids 29 to 439 (411 residues), 38.6 bits, see alignment E=3.8e-14

Best Hits

Swiss-Prot: 95% identical to TDCC_ENT38: Threonine/serine transporter TdcC (tdcC) from Enterobacter sp. (strain 638)

KEGG orthology group: K03838, threonine transporter (inferred from 98% identity to enc:ECL_04510)

MetaCyc: 89% identical to threonine/serine:H+ symporter TdcC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"L-threonine transporter, anaerobically inducible" in subsystem Threonine anaerobic catabolism gene cluster or Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>EX28DRAFT_3177 serine transporter (Enterobacter asburiae PDN3)
MSNTESIIVGQTKTSSWRKSDTTWTLGLFGTAIGAGVLFFPIRAGFGGLIPILLMLVLAF
PIAFYCHRALARLCLSGSNVSGNITETVEEHFGKTGGVVITFLYFFAICPLLWIYGVTIT
NTFMTFWENQLQLPALNRGVVALFLLLLMAFVIWFGKDLMVKVMSFLVFPFIASLVLISL
SLIPYWNSAVIDQVNLSDIAFTGHDGILVTVWLGISIMVFSFNFSPIVSSFVVSKREEYE
PEFGKAFTEQKCSKIIGRASLLMVAVVMFFAFSCLFTLSPQNMADAKAQNIPVLSYLANH
FASMSGTKSTFATVLEYGASIIALVAIFKSFFGHYLGTLEGLNGLILKFGYKGDKKKVSV
GKLNTISMVFIMGSTWVVAYANPNILDLIEAMGAPIIASLLCLLPMYAIRKAPALAKYKG
RTENIFVTAVGLLTILNIVYKLF