Protein Info for EX28DRAFT_3163 in Enterobacter asburiae PDN3

Annotation: Uncharacterized membrane-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 23 to 88 (66 residues), see Phobius details amino acids 123 to 148 (26 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details PF09335: VTT_dom" amino acids 48 to 173 (126 residues), 75.8 bits, see alignment E=2.1e-25

Best Hits

Swiss-Prot: 94% identical to YQJA_ECO57: Inner membrane protein YqjA (yqjA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to enc:ECL_04495)

Predicted SEED Role

"DedA family inner membrane protein YqjA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>EX28DRAFT_3163 Uncharacterized membrane-associated protein (Enterobacter asburiae PDN3)
MELLTQLLHALWAQDFETLANPSMIGMLYFVLFMILFLENGLLPAAFLPGDSLLVLVGVL
CAKGAMAFPHTILLLTVAASLGCWVSYIQGRWLGNTRIVQNWLSHLPAHYHQRAHHLFHK
HGLSALLIGRFIAFVRTLLPTIAGLSGLSSARFQFFNWMSGLLWVLILTTLGYALGKTPV
FMKYEDQLMSCLMLLPVVLLVFGLIGSLVVLWKKKYGARG