Protein Info for EX28DRAFT_3145 in Enterobacter asburiae PDN3

Annotation: DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF01791: DeoC" amino acids 51 to 259 (209 residues), 74.8 bits, see alignment E=4.2e-25

Best Hits

Swiss-Prot: 94% identical to LSRF_ENT38: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase (lsrF) from Enterobacter sp. (strain 638)

KEGG orthology group: K08321, putative autoinducer-2 (AI-2) aldolase [EC: 4.1.2.-] (inferred from 96% identity to enc:ECL_04478)

MetaCyc: 77% identical to 3-hydroxy-2,4-pentadione 5-phosphate thiolase (Escherichia coli K-12 substr. MG1655)
RXN-15943 [EC: 2.3.1.245]

Predicted SEED Role

"Autoinducer 2 (AI-2) aldolase LsrF (EC 4.2.1.-)" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-, 4.2.1.-

Use Curated BLAST to search for 2.3.1.245 or 4.1.2.- or 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>EX28DRAFT_3145 DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes (Enterobacter asburiae PDN3)
MADLDDIKDGKDFGIGTPQQNVPYTLKGCGSLDWGMQSRLARIFNPQSNRTVMLAFDHGY
FQGPTTGLERIDLSIAPLFGETDVLMCTRGILRSQVPAATNKPVVLRASGGNSILGELSN
ECVAVAMEDALRLNVCAVAAQVYIGSEFEHQSINNIIKLVDAGARYGMPTLAVTGVGKEM
ARDARYFSLASRIAAEMGAQFVKTYYVDEGFEKVTASCPVPIVIAGGKKLPEHEALEMCW
RAIDQGASGVDMGRNIFQSSAPLAMLKAVKKVVHENWNARDAFQFWQEEKQGEAK